Analytical Data
-
Gene name
LMP7
- Application
-
Alternative Names
LMP7；LMP7；PSMB5i；RING10；Proteasome subunit beta type-8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28062
-
Expression Region
73-276aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMTTTLAFKFQHGVIAAVDSRASAGSY ISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERIS VSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNM FSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVN MYHMKEDGWVKVESTDVSDLLHQYREANQ
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LMP7, a member of the immunoproteasome family, plays a crucial role in antigen processing and presentation in immune responses. Unlike the constitutive proteasome, the immunoproteasome is activated during immune-related stress and inflammation, enhancing the production of peptide fragments that bind to major histocompatibility complex (MHC) class I molecules. This process is vital for the effective activation of CD8+ T cells, which are critical in eliminating infected or malignant cells. Research into LMP7 recombinant protein has gained momentum due to its potential implications in immunotherapy and vaccine development. Understanding its structure and function can aid in designing strategies to boost immune responses against tumors and chronic infections. Furthermore, LMP7 is being investigated for its role in various autoimmune diseases, where an imbalance in proteasome function may lead to aberrant immune activity. The recombinant production of LMP7 allows for detailed biochemical studies and the exploration of its interactions with other proteins, providing insights into its function in the immune system. As a target for therapeutic intervention, modulating LMP7 activity could lead to innovative treatments that enhance immunity or mitigate autoimmune disorders. Thus, the research on LMP7 recombinant protein not only contributes to fundamental immunology but also holds promise for advancing clinical applications in immunotherapy and disease management.
