Analytical Data
-
Gene name
ZC3H7A
- Application
-
Alternative Names
ZC3H7A; ZC3H7; ZC3HDC7; HSPC055; Zinc finger CCCH domain-containing Protein 7A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IWR0
-
Expression Region
1-167 aa
-
AA Sequence
MKENGIQDMEQFYELWLKSQKNEKSEDIASQSNKENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDFGKYSFLFKDLN
-
Molecular Weight
46.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ZC3H7A protein, a member of the zinc finger protein family, has garnered attention in recent years for its potential roles in cellular processes such as transcriptional regulation, RNA binding, and stress response. Research has suggested that ZC3H7A might be involved in important biological pathways, including immune response modulation and developmental regulation. Understanding the structure and function of ZC3H7A is crucial as it may play a significant role in various diseases, including cancer and autoimmune disorders. The study of recombinant ZC3H7A protein allows researchers to investigate its biochemical properties, interactions with other cellular molecules, and its functional implications in disease mechanisms. By producing this protein in a recombinant form, scientists can conduct detailed analyses, including binding assays and functional studies, to decipher the molecular underpinnings of its activity and potential therapeutic avenues. The insights gained from such research can pave the way for novel diagnostic and treatment strategies, highlighting the importance of ZC3H7A in both basic biology and medical research.
