Cat: PAX2000-11897

Recombinant Human TCTA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TCTA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    T-cell leukemia translocation altered gene; T-cell leukemia translocation-altered gene Protein; T-cell leukemia translocation-associated gene Protein; Tcta; TCTA_HUMAN

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P57738

  • Expression Region

    1-103 aa

  • AA Sequence

    MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFY GNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE

  • Molecular Weight

    11.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TCTA, or Transcriptional Co-Activator with PDZ-Motif, is a protein that plays a crucial role in various cellular processes, including transcription regulation, cell signaling, and the maintenance of stem cell pluripotency. Research on TCTA is driven by its involvement in numerous physiological and pathological conditions, such as cancer, where its dysregulation may contribute to tumor progression and metastasis. In recent years, scientists have focused on the biochemical characterization and functional analysis of TCTA to understand its mechanisms of action and interaction pathways within the cell. The recombinant production of TCTA has become a valuable tool for studying its properties and potential as a therapeutic target. By using techniques like recombinant DNA technology, researchers can produce large quantities of TCTA, allowing for in-depth investigations into its structure-function relationships and interactions with other proteins. The insights gained from these studies may not only illuminate the biological significance of TCTA but also pave the way for the development of novel strategies in cancer therapy and regenerative medicine. Understanding TCTA’s role in cellular processes can provide foundational knowledge that bridges gaps in our comprehension of how transcriptional regulation impacts human health and disease. Overall, the research into TCTA and its recombinant protein forms represents a promising frontier in molecular biology and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US