Cat: PA2000-7272

Recombinant Human EDEM1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EDEM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EDEM1; EDEM; KIAA0212ER degradation-enhancing alpha-mannosidase-like protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92611

  • Expression Region

    559-656

  • AA Sequence

    YLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGL

  • Molecular Weight

    36.52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EDEM1 (ER degradation-enhancing α-mannosidase I-like protein 1) is a crucial component of the endoplasmic reticulum (ER) associated degradation (ERAD) pathway, which is responsible for the quality control of glycoproteins. Proteins that are misfolded or improperly glycosylated are targeted for degradation to maintain cellular homeostasis. EDEM1 specifically functions in recognizing and extracting these defective glycoproteins from the ER lumen, facilitating their transport to the proteasome for degradation. The research surrounding EDEM1 has gained significance due to its potential implications in various diseases, including neurodegenerative disorders and cancer, where protein misfolding and aggregation are common. Furthermore, EDEM1’s role in the immune response and its influence on glycoprotein maturation highlight its importance in cellular functions. Studies have also explored the structural and functional mechanisms of EDEM1, helping to elucidate its interactions with glycoproteins and other components of the ERAD pathway. Understanding EDEM1 can provide insights into therapeutic strategies for diseases associated with protein misfolding, making it a significant focus of biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US