Analytical Data
-
Gene name
EDEM1
- Application
-
Alternative Names
EDEM1; EDEM; KIAA0212ER degradation-enhancing alpha-mannosidase-like protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92611
-
Expression Region
559-656
-
AA Sequence
YLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGL
-
Molecular Weight
36.52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EDEM1 (ER degradation-enhancing α-mannosidase I-like protein 1) is a crucial component of the endoplasmic reticulum (ER) associated degradation (ERAD) pathway, which is responsible for the quality control of glycoproteins. Proteins that are misfolded or improperly glycosylated are targeted for degradation to maintain cellular homeostasis. EDEM1 specifically functions in recognizing and extracting these defective glycoproteins from the ER lumen, facilitating their transport to the proteasome for degradation. The research surrounding EDEM1 has gained significance due to its potential implications in various diseases, including neurodegenerative disorders and cancer, where protein misfolding and aggregation are common. Furthermore, EDEM1’s role in the immune response and its influence on glycoprotein maturation highlight its importance in cellular functions. Studies have also explored the structural and functional mechanisms of EDEM1, helping to elucidate its interactions with glycoproteins and other components of the ERAD pathway. Understanding EDEM1 can provide insights into therapeutic strategies for diseases associated with protein misfolding, making it a significant focus of biomedical research.
