Analytical Data
-
Gene name
EDG1
- Application
-
Alternative Names
S1PR1; CHEDG1; EDG1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21453
-
Expression Region
1-382aa
-
AA Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
-
Molecular Weight
69.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The EDG1 protein, a member of the endothelial differentiation gene (EDG) family, plays a critical role in various physiological processes, particularly in the regulation of vascular functions and immune responses. Initially identified for its involvement in endothelial cell differentiation, EDG1 is a G-protein-coupled receptor (GPCR) that binds to sphingosine 1-phosphate (S1P), a bioactive lipid mediator crucial for promoting angiogenesis, cell proliferation, and lymphocyte trafficking. Given its significant roles, EDG1 has garnered attention in research focused on cardiovascular diseases, cancer progression, and autoimmune disorders. Understanding the structural and functional characteristics of EDG1, particularly through the study of its recombinant forms, can provide insights into its mechanisms of action and potential therapeutic targets. Recent advances in protein engineering and expression systems have facilitated the production of EDG1 recombinant proteins, enabling comprehensive studies of their interactions and signaling pathways. This research is vital for developing novel pharmacological strategies aimed at modulating EDG1 activity in various pathological conditions, thereby addressing critical gaps in current therapeutic approaches.
