Analytical Data
-
Gene name
ZBTB7A
- Application
-
Alternative Names
Factor binding IST Protein 1; Factor that binds to inducer of short transcripts Protein 1; FBI 1; FBI-1; FBI1; HIV 1 1st binding Protein 1; HIV-1 1st-binding Protein 1; Leukemia/lymphoma related factor; Leukemia/lymphoma-related factor; LRF; POK erythroid myeloid ontogenic factor; Pokemon; POZ and Krueppel erythroid myeloid ontogenic factor; TIP21; TTF I interacting peptide 21; TTF-I-interacting peptide 21; ZBT7A_HUMAN; ZBTB7; ZBTB7A; Zinc finger and BTB domain containing Protein 7A; Zinc finger and BTB domain-containing Protein 7A; Zinc finger Protein 857A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95365
-
Expression Region
1-108 aa
-
AA Sequence
MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA
-
Molecular Weight
37.62 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZBTB7A, also known as ZNF217, is a member of the BTB/POZ domain-containing zinc finger protein family and plays a critical role in various biological processes, including transcriptional regulation, cell proliferation, and differentiation. Its involvement in oncogenesis has garnered significant interest, as ZBTB7A has been identified as an oncogene in several cancers, such as breast and prostate cancer, where it promotes tumor growth by regulating key signaling pathways and influencing gene expression. The study of ZBTB7A recombinant protein is crucial for elucidating its functional mechanisms, providing insights into its role in cancer biology. Research efforts focus on producing and characterizing this protein to explore its interactions with other cellular molecules and pathways. By investigating the structural and functional properties of ZBTB7A, scientists aim to identify potential therapeutic targets and develop strategies for cancer treatment, especially considering its pivotal role in tumorigenesis. Understanding this protein at the molecular level could also contribute to the broader field of epigenetics and transcriptional regulation, leading to advancements in personalized medicine and targeted therapies.
