Analytical Data
-
Gene name
MCP2
- Application
-
Alternative Names
MCP2；MCP2；SCYA10；SCYA8；C-C motif chemokine 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P80075
-
Expression Region
24-99aa
-
AA Sequence
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKE VCADPKERWVRDSMKHLDQIFQNLKP
-
Molecular Weight
9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MCP2 (Monocyte Chemotactic Protein 2) is a member of the CC chemokine family and plays a crucial role in immune response and inflammation by attracting monocytes and other immune cells to sites of injury or infection. Research on MCP2 recombinant proteins has gained significant interest due to their potential therapeutic applications in treating inflammatory diseases, atherosclerosis, and certain cancers. The recombinant form of MCP2 allows for detailed studies of its structure-function relationships and mechanisms of action, enabling researchers to explore its signaling pathways in various cellular contexts. Moreover, MCP2's involvement in the pathogenesis of several chronic conditions has prompted investigations into its role as a biomarker for disease progression and response to therapy. By utilizing advanced techniques in protein engineering and biochemistry, researchers aim to enhance the stability and efficacy of MCP2 for therapeutic use. Understanding MCP2's interactions with its receptors and downstream signaling pathways can provide insights into novel strategies for modulating immune responses, leading to improved clinical outcomes in inflammatory and autoimmune diseases. Thus, the study of MCP2 recombinant proteins not only advances basic scientific knowledge but also holds promise for the development of innovative therapeutic interventions in immunology and oncology.
