Analytical Data
-
Gene name
CCK
- Application
-
Alternative Names
CCK；CCKRA；Cholecystokinin receptor type A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07108
-
Expression Region
2-104aa
-
AA Sequence
WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
-
Molecular Weight
15.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCK (Cholecystokinin) is a peptide hormone primarily produced in the small intestine that plays a crucial role in digestion and appetite regulation. It stimulates the gallbladder to contract and release bile, facilitating fat digestion, and triggers the release of digestive enzymes from the pancreas. The CCK receptor is also involved in signaling pathways that regulate satiety, making it a target for obesity and metabolic disorder research. Recent studies have focused on the recombinant production of CCK proteins to better understand their structure-function relationships and therapeutic potential. The use of recombinant DNA technology allows researchers to produce large quantities of CCK for various applications, including drug development and the study of gastrointestinal diseases. Moreover, understanding how CCK interacts with its receptors could lead to novel treatments for conditions such as obesity, eating disorders, and chronic pancreatitis. Overall, the exploration of recombinant CCK proteins represents a significant advancement in both fundamental and clinical research concerning gastrointestinal physiology and metabolism.
