Cat: PAX2000-12588

Recombinant Human XTP3TPA Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    XTP3TPA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    dCTP pyrophosphatase 1. EC:3.6.1.12. Deoxycytidine-triphosphatase 1. dCTPase 1. RS21C6. XTP3-transactivated gene A Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H773

  • Expression Region

    1-170 aa

  • AA Sequence

    MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

  • Molecular Weight

    45.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

XTP3TPA is a recombinant protein that has garnered significant attention in the field of molecular biology and biochemistry due to its potential applications in understanding intracellular signaling pathways and cellular responses. This protein is derived from specific organisms, and its role is believed to be crucial in mediating stress responses, enhancing tolerance to environmental changes, and regulating various physiological processes. The study of XTP3TPA is particularly relevant in the context of plant biology, where its functions may contribute to improved crop resilience and productivity under adverse conditions. Researchers are focused on elucidating the structural and functional characteristics of XTP3TPA, with an aim to harness its biological properties for agricultural and biotechnological innovations. Furthermore, understanding the mechanisms through which XTP3TPA operates may provide insights into the evolutionary adaptations of organisms to their environments, as well as potential applications in synthetic biology. Therefore, the exploration of this recombinant protein is not only pivotal for advancing fundamental research but also holds promise for practical applications in enhancing sustainable agriculture and environmental resilience.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US