Analytical Data
-
Gene name
XRN2
- Application
-
Alternative Names
XRN2; 5'-3' exoribonuclease 2; EC 3.1.13.-; DHM1-like Protein; DHP Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0D6
-
Expression Region
1-615 aa
-
AA Sequence
WKQRYYKNKFDVDAADEKFRRKVVQSYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMGVFPAASGNFLPPSWR
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
XRN2, a 5' to 3' exonuclease, plays a critical role in the regulation of mRNA stability and processing, which are essential for gene expression and cellular homeostasis. Recent studies have highlighted XRN2's involvement in various biological processes, including transcription termination and the degradation of aberrant RNA molecules. Given its significance, researchers have focused on the structural and functional characterization of XRN2, aiming to better understand its enzymatic mechanisms and regulatory pathways. The production of recombinant XRN2 protein has become a crucial step in these investigations, facilitating enzyme activity assays, interaction studies, and the exploration of its substrate specificity. Furthermore, understanding how XRN2's activities are regulated can provide insights into its roles in disease contexts, such as cancer and viral infections, where dysregulation of mRNA processing is observed. By elucidating the precise functions and mechanisms of XRN2 through recombinant protein studies, researchers hope to develop potential therapeutic strategies that target these pathways, ultimately contributing to advancements in molecular biology and medicine.
