Analytical Data
-
Gene name
DUS3L
- Application
-
Alternative Names
mRNA-dihydrouridine synthase DUS3L;tRNA-dihydrouridine synthase 3-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96G46
-
Expression Region
2-650aa
-
AA Sequence
AEGTAEAPLENGGGGDSGAGALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLRPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPCEKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQYIEECVQAASPMPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEMLLGPVPPSFAFLPKHKANAYK
-
Molecular Weight
73.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUS3L, or double-stranded RNA (dsRNA) binding protein, plays a critical role in cellular responses to viral infections and in the regulation of gene expression through its interaction with dsRNA molecules. Its involvement in the immune response, particularly in the context of antiviral defense mechanisms, has garnered significant research interest. The protein's ability to recognize and bind to dsRNA enables it to modulate the activation of various signaling pathways, including those associated with the interferon response. Researchers are particularly focused on understanding the structural and functional properties of DUS3L, as alterations in its activity may influence pathophysiological conditions, including autoimmune diseases and cancer. Given the rising prevalence of viral infections and the complexity of the immune response, elucidating the mechanisms by which DUS3L modulates dsRNA interactions could offer novel therapeutic avenues. Current studies are aimed at characterizing the protein’s binding affinities, the conformational changes upon dsRNA binding, and the biological implications of these interactions. Overall, the DUS3L protein represents a promising target for research that could lead to enhanced antiviral strategies and a deeper understanding of immune regulation.











