Analytical Data
-
Gene name
XLKD1
- Application
-
Alternative Names
Cell surface retention sequence-binding Protein 1; CRSBP 1; CRSBP-1; CRSBP1; extracellular link domain containing 1; extracellular link domain-containing 1; Extracellular link domain-containing Protein 1; HAR; Hyaluronic acid receptor; Lymphatic endothelium specific hyaluronan receptor ; lymphatic vessel endothelial hyaluronan receptor 1; Lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE 1; LYVE-1; LYVE1; LYVE1_HUMAN; XLKD1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5Y7
-
Expression Region
1-322 aa
-
AA Sequence
MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIRKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV
-
Molecular Weight
61.16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
XLKD1, a member of the Kelch domain-containing protein family, has garnered significant attention in recent years due to its potential role in various cellular processes, including cytoskeletal dynamics and signal transduction. Research has indicated that XLKD1 may be involved in critical functions such as regulating cell migration, proliferation, and differentiation, making it a subject of interest in both developmental biology and cancer research. The protein is thought to interact with actin and microtubule structures, suggesting its involvement in maintaining cellular architecture and integrity. Moreover, mutations or dysregulation of XLKD1 have been implicated in certain diseases, highlighting its importance in maintaining cellular homeostasis. As such, the study of XLKD1 recombinant protein is crucial for elucidating its molecular mechanisms of action. By generating and characterizing XLKD1 recombinant proteins, researchers aim to better understand its interactions and functions within the cell, potentially paving the way for therapeutic applications. This research not only provides insights into the fundamental biology of XLKD1 but also holds promise for developing strategies to target its pathways in disease contexts, thereby advancing our knowledge of cellular function and disease pathogenesis. Exploring the biochemical properties and functional assays of XLKD1 recombinant protein can thus contribute to a deeper understanding of its role in health and disease.
