Analytical Data
-
Gene name
XPMC2H
- Application
-
Alternative Names
REXO4; PMC2; XPMC2H; RNA exonuclease 4; Exonuclease XPMC2; Prevents mitotic catastrophe 2 Protein homolog; hPMC2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZR2
-
Expression Region
1-422 aa
-
AA Sequence
MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSDDA
-
Molecular Weight
73.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The XPMC2H recombinant protein has garnered significant interest in the field of biotechnology and molecular biology due to its potential applications in therapeutic and diagnostic research. XPMC2H, identified as a member of the PMC2H domain family, is implicated in various cellular processes including signaling pathways and protein interactions. Its structure suggests a role in regulating cellular functions, which has prompted investigations into its mechanism and activity. Previous studies indicate that the expression of XPMC2H can influence cell proliferation and apoptosis, prompting researchers to explore its potential as a target for cancer therapy and regenerative medicine. Moreover, the ability to produce XPMC2H as a recombinant protein allows for detailed structural and functional analyses, enabling the design of inhibitors or enhancers that could modulate its activity in cellular contexts. The growing body of literature surrounding XPMC2H highlights its promise in uncovering new avenues for therapeutic interventions and enhances our understanding of its role in disease mechanisms. Consequently, ongoing research aims to elucidate the biochemical properties of XPMC2H and its interactions within the cellular network, paving the way for innovative strategies in treating various conditions.
