Analytical Data
-
Gene name
C3
- Application
-
Alternative Names
C3；General transcription factor 3C polypeptide 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01024
-
Expression Region
672-747aa
-
AA Sequence
SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACK KVFLDCCNYITELRRQHARASHLGLA
-
Molecular Weight
9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3 recombinant protein research is rooted in the exploration of complement system components, specifically C3, a crucial protein involved in immune responses. The complement system is a vital part of the innate immune system, playing a key role in pathogen recognition, opsonization, and inflammation. C3 acts as a central connector, undergoing cleavage to yield active fragments that mediate various immunological functions. Understanding C3's structure and function has significant implications for developing therapeutic strategies against a range of diseases, including autoimmune disorders, infections, and inflammatory conditions. Advances in recombinant DNA technology have enabled the production of C3 and its derivatives, allowing researchers to investigate their roles in immune modulation and potential treatment pathways. Additionally, studying C3 recombinant proteins helps elucidate the mechanisms of complement activation and regulation, providing insights into pathological processes and paving the way for targeted interventions. The significant interest in C3 and its implications in health and disease has spurred ongoing research aimed at harnessing its potential in biomarker discovery and therapeutic development.
