Analytical Data
-
Gene name
C4
- Application
-
Alternative Names
C4;DPDE1;3'.5'-cyclic-AMP phosphodiesterase 4C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C0L4
-
Expression Region
1454-1744aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAPKVVEEQESRVHYTVCIWR NGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLL YFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPS KSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVE YGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCR LRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQR AACAQLNDFLQEYGTQGCQV
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C4 recombinant protein research focuses on the development and application of a specific type of protein derived from the complement system, which plays a crucial role in the immune response. The complement system is a part of the innate immune system, consisting of a series of proteins that work together to enhance the ability of antibodies and phagocytic cells to clear pathogens from an organism. C4, in particular, is involved in the classical and lectin pathways of complement activation. Its recombinant form allows for detailed studies of its structure and function, as well as its interactions with other components of the immune system. The need for C4 recombinant proteins has increased due to their potential applications in therapeutic interventions, such as treating autoimmune diseases, improving vaccine efficacy, and enhancing organ transplantation outcomes. Additionally, understanding the precise mechanisms of C4 in complement regulation may lead to the development of novel immunomodulatory strategies. Researchers are also investigating the genetic and environmental factors that influence C4 levels and activity, as variations in C4 have been associated with susceptibility to various diseases, including systemic lupus erythematosus and other inflammatory conditions. Overall, the study of C4 recombinant proteins stands at the intersection of immunology, molecular biology, and therapeutic innovation, offering promising avenues for improving human health and disease management.











