Cat: PA1000-8099

Recombinant Human C4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C4;DPDE1;3'.5'-cyclic-AMP phosphodiesterase 4C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0C0L4

  • Expression Region

    1454-1744aa

  • AA Sequence

    MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAPKVVEEQESRVHYTVCIWR NGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLL YFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPS KSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVE YGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCR LRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQR AACAQLNDFLQEYGTQGCQV

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C4 recombinant protein research focuses on the development and application of a specific type of protein derived from the complement system, which plays a crucial role in the immune response. The complement system is a part of the innate immune system, consisting of a series of proteins that work together to enhance the ability of antibodies and phagocytic cells to clear pathogens from an organism. C4, in particular, is involved in the classical and lectin pathways of complement activation. Its recombinant form allows for detailed studies of its structure and function, as well as its interactions with other components of the immune system. The need for C4 recombinant proteins has increased due to their potential applications in therapeutic interventions, such as treating autoimmune diseases, improving vaccine efficacy, and enhancing organ transplantation outcomes. Additionally, understanding the precise mechanisms of C4 in complement regulation may lead to the development of novel immunomodulatory strategies. Researchers are also investigating the genetic and environmental factors that influence C4 levels and activity, as variations in C4 have been associated with susceptibility to various diseases, including systemic lupus erythematosus and other inflammatory conditions. Overall, the study of C4 recombinant proteins stands at the intersection of immunology, molecular biology, and therapeutic innovation, offering promising avenues for improving human health and disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US