Analytical Data
-
Gene name
DSCR9
- Application
-
Alternative Names
DSCR9Down syndrome critical region protein 9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P59020
-
Expression Region
1-149aa
-
AA Sequence
MGRICPVNSRARRLRARPGRPSGDSLPYHQLQGGAPRLWSPDPGRPAAYRRAHVCDVTAPRWGSTSRQGEGAVLQRMLGRRAPPSWSRDHAYSRRGWENAALFLNRKRKQEGTENTSICCRPESALACGGNLSPQFLKKVIQIQTQELW
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The DSCR9 protein, associated with the Down syndrome critical region on chromosome 21, has garnered significant interest in biomedical research due to its potential implications in Down syndrome and related disorders. Research indicates that DSCR9 may play a role in the regulation of various cellular processes, including apoptosis, cell proliferation, and stress response, which are critical in neurodevelopmental contexts. The overexpression of genes located in the Down syndrome critical region is believed to contribute to the cognitive and physiological characteristics seen in individuals with Down syndrome. Investigating the structure and function of DSCR9 is essential for understanding its biological pathways and molecular mechanisms, which could provide insights into therapeutic targets. Moreover, studying recombinant forms of DSCR9 can facilitate the exploration of its interactions with other proteins, revealing its role in neuronal development and potential contributions to cognitive deficits. As research advances, the characterization of DSCR9 may pave the way for novel interventions aimed at ameliorating the effects of Down syndrome and enhancing the quality of life for affected individuals.
