Cat: PA1000-8092

Recombinant Human C9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C9;Complement component C9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P02748

  • Expression Region

    22-559aa

  • AA Sequence

    QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFG QFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNG DNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTP FDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQI EAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFR FSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVD DIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKG VELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENL IDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQ KLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVIL MDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK

  • Molecular Weight

    85 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C9 recombinant protein research is a significant area in the field of molecular biology and biotechnology, focusing on the understanding and application of C9 protein, a crucial component involved in various physiological processes. C9, or complement component 9, plays a vital role in the complement system, which is an integral part of the immune response, helping to opsonize pathogens and facilitate their elimination. The manipulation and study of C9 through recombinant techniques allow researchers to explore its structure-function relationships, post-translational modifications, and interactions with other complement components. As the prevalence of complement system-related diseases, such as autoimmune disorders and inflammatory responses, rises, understanding C9's role can lead to novel therapeutic strategies. Furthermore, the production of C9 recombinant protein in suitable expression systems offers opportunities for high-yield generation for experimental use, including structural studies and potential clinical applications. This advances our understanding of immune regulation and could pave the way for new treatments for diseases linked to complement dysfunction. The ongoing research may also contribute to vaccine development and improve diagnostic tools in immunology. Overall, C9 recombinant protein studies represent a frontier in both fundamental and applied research, bridging gaps in our knowledge of immune mechanisms and presenting opportunities for innovative medical breakthroughs.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US