Analytical Data
-
Gene name
CFHR3
- Application
-
Alternative Names
CFHR3；CFHL3；FHR3；Complement factor H-related Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02985
-
Expression Region
19-330aa
-
AA Sequence
QVKPCDFPDIKHGGLFHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDYIHCTQNGWS PAVPCLRKCYFPYLENGYNQNYGRKFVQGNSTEVACHPGYGLPKAQTTVTCTEKGWSPTP RCIRVRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWS AQPICINSSEKCGPPPPISNGDTTSFLLKVYVPQSRVEYQCQPYYELQGSNYVTCSNGEW SEPPRCIHPCIITEENMNKNNIKLKGRSDRKYYAKTGDTIEFMCKLGYNANTSILSFQAV CREGIVEYPRCE
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CFHR3, or complement factor H-related protein 3, is a member of the complement factor H (CFH) family, which plays a crucial role in the regulation of the complement system—a key component of the immune response. Understanding CFHR3 is particularly important due to its association with various ocular diseases, such as age-related macular degeneration (AMD) and other inflammatory conditions. Recent studies have indicated that CFHR3 may have distinct functional roles that differentiate it from CFH, suggesting that it could be involved in modulating the inflammatory response and pathogen recognition. The investigation of CFHR3 recombinant proteins is essential for elucidating the molecular mechanisms underlying these associations, offering potential insights into therapeutic targets for complement-related disorders. Additionally, recombinant CFHR3 can be utilized in biochemical assays to explore its interactions with other proteins in the complement pathway, thus contributing to a broader understanding of immune dysregulation. As the prevalence of complement-mediated diseases increases globally, the research on CFHR3 recombinant proteins is of significant interest for both basic science and clinical applications, aiming to develop novel diagnostic and therapeutic strategies.
