Analytical Data
-
Gene name
DSCR6
- Application
-
Alternative Names
RIPPLY3; DSCR6Protein ripply3; Down syndrome critical region protein 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57055
-
Expression Region
1-190aa
-
AA Sequence
MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK
-
Molecular Weight
46.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The DSCR6 protein, a member of the Down syndrome chromosomal region 6 (DSCR6) family, has garnered interest due to its potential implications in developmental biology and human health. Located on chromosome 21, DSCR6 is part of a region that is implicated in Down syndrome, a genetic disorder caused by trisomy of this chromosome. Research suggests that DSCR6 may play a crucial role in neuronal development and function, contributing to the cognitive and physical challenges associated with Down syndrome. Furthermore, studies have indicated that alterations in DSCR6 expression can impact cellular processes such as proliferation and apoptosis, raising questions about its role in oncogenesis. Investigating DSCR6's structure, function, and regulatory mechanisms is essential for understanding its biological significance, particularly in the context of developmental disorders and cancer. The modulation of DSCR6 has potential therapeutic implications, making it a target for studies aiming to mitigate the effects of Down syndrome and other related disorders. Overall, the exploration of DSCR6 is an important avenue in molecular biology, with far-reaching effects for both basic research and clinical applications.
