Cat: PA1000-8088

Recombinant Human PTCH1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PTCH1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PTCH1;PTCH;Protein patched homolog 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13635

  • Expression Region

    68-249aa

  • AA Sequence

    MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGL KAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEG ANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYM DQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLL

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PTCH1 (Patched 1) is a crucial component of the Hedgehog signaling pathway, playing a pivotal role in embryonic development and cellular homeostasis. Mutations in the PTCH1 gene are linked to various human conditions, including Gorlin syndrome, which predisposes individuals to multiple basal cell carcinomas and other neoplasms. The study of PTCH1 recombinant proteins has gained importance in understanding the molecular mechanisms governing cell signaling and cancer biology. Researchers often focus on the expression, purification, and functional analysis of PTCH1 to elucidate its interactions with ligands like Sonic Hedgehog and its downstream effectors. By utilizing recombinant technology, scientists create PTCH1 proteins that can be studied in vitro, providing insights into its structural properties and biochemical functions. Additionally, these studies are crucial for developing therapeutic strategies targeting Hedgehog signaling in cancer and other diseases. Investigating PTCH1 recombinant proteins also aids in the identification of small molecules or monoclonal antibodies that can modulate this pathway, potentially leading to innovative treatment options. Overall, the exploration of PTCH1 recombinant proteins stands as a significant advancement in tumor biology and developmental research, highlighting the importance of this protein in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US