Analytical Data
-
Gene name
DSCR4
- Application
-
Alternative Names
DCRB; Down syndrome critical region protein 4; Down syndrome critical region protein B; DSCR4; DSCR4_HUMAN; DSCRB
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56555
-
Expression Region
1-118aa
-
AA Sequence
MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGRRDKQISASPST
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The DSCR4 (Down syndrome critical region 4) protein is located within the chromosomal region 21q22.2, which is critical for understanding the pathophysiology of Down syndrome (DS), a genetic disorder caused by the presence of an extra copy of chromosome 21. Emerging research has highlighted DSCR4 as a candidate gene that may contribute to the phenotypic features observed in individuals with Down syndrome, including cognitive deficits and cardiac anomalies. DSCR4 is believed to play a role in cellular processes such as cell proliferation, apoptosis, and stress response, which are pertinent to Down syndrome's complex developmental and physiological challenges. Investigations into the structure and function of DSCR4 protein have revealed its potential involvement in neurodevelopmental pathways, making it a significant focus for studies aimed at deciphering the molecular mechanisms underpinning brain development and function in both typical and atypical contexts. Furthermore, the study of DSCR4 may provide insights into potential therapeutic strategies to mitigate the adverse effects of DS in affected individuals. As research continues to unravel the implications of DSCR4 in cellular and systemic contexts, it remains an essential target for further exploration in the quest to improve outcomes for those with Down syndrome. This ongoing investigation is expected to offer new avenues for understanding the intricate interplay of genetics, biology, and the environment in shaping the lives of individuals with this disorder.
