Analytical Data
-
Gene name
TAS2R7
- Application
-
Alternative Names
TAS2R7; Taste receptor type 2 member 7; T2R7; Taste receptor family B member 4; TRB4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYW3
-
Expression Region
1-318 aa
-
AA Sequence
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLCVILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFLWMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISFLLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVIWKVMSILKGRKFQQHKQI
-
Molecular Weight
62.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAS2R7, a member of the bitter taste receptor family, is a G protein-coupled receptor that plays a crucial role in the perception of bitter compounds, which can be important for dietary choices and the avoidance of potentially toxic substances. Research into TAS2R7 has gained interest due to its potential implications in various physiological processes, including taste perception, food preferences, and even metabolic regulation. Understanding the function and signaling pathways of TAS2R7 can provide insights into how bitter taste perception influences behavior and health outcomes. Furthermore, studies on TAS2R7 may have broader implications in fields such as pharmacology and toxicology, given that many environmental toxins and medications can elicit bitter taste responses. The production and characterization of recombinant TAS2R7 proteins have become a key focus of research, facilitating biochemical assays and advanced structural studies. Such work not only enhances our comprehension of the receptor's molecular mechanisms but also paves the way for potential therapeutic applications targeting taste-related disorders or enhancing the palatability of certain foods. Overall, ongoing research into TAS2R7 reaffirms the importance of taste perception in human health and disease, highlighting the intricate relationship between taste receptors and environmental interactions.
