Cat: PAX2000-12566

Recombinant Human WNK3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WNK3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KIAA1566; PRKWNK 3; PRKWNK3; Protein kinase lysine deficient 3; Protein kinase lysine-deficient 3; Protein kinase with no lysine 3; Serine/threonine Protein kinase WNK3; Serine/threonine-Protein kinase WNK3; WNK 3; WNK lysine deficient Protein kinase 3; Wnk3; WNK3_HUMAN

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BYP7

  • Expression Region

    1-571 aa

  • AA Sequence

    MATDSGDPASTEDSEKPDGISFENRVPQVAATLTVEARLKEKNSTFSASG ETVERKRFFRKSVEMTEDDKVAESSPKDERIKAAMNIPRVDKLPSNVLRG GQEVKYEQCSKSTSEISKDCFKEKNEKEMEEEAEMKAVATSPSGRFLKFD IELGRGAFKTVYKGLDTETWVEVAWCELQDRKLTKAEQQRFKEEAEMLKG LQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLKRFKVMKPKVL RSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATL MRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSE CQNAAQIYRKVTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIRDLL NHAFFAEDTGLRVELAEEDDCSNSSLALRLWVEDPKKLKGKHKDNEAIEF SFNLETDTPEEVAYEMVKSGFFHESDSKAVAKSIRDRVTPIKKTREKKPA GCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQ LLQRKPQQHCSSVTGDNLSEA

  • Molecular Weight

    91 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WNK3 (With No lysine (K)) is a member of the WNK kinase family, which plays a crucial role in the regulation of ion transport and blood pressure homeostasis. This kinase has garnered significant attention due to its involvement in various physiological processes, particularly in the kidneys, where it modulates the activity of ion channels and transporters. Mutations in the WNK3 gene have been linked to hypertension and other cardiovascular disorders, highlighting its importance in maintaining electrolyte balance. Researchers have increasingly focused on recombinant WNK3 protein to unravel its functional mechanisms and explore its role in pathological states. By producing and studying this protein in a controlled laboratory environment, scientists can investigate its interactions with upstream regulators and downstream effectors, elucidating the signaling pathways it influences. Furthermore, understanding the structure-function relationship of WNK3 may provide insights into the development of novel therapeutic strategies for conditions related to ion transport dysregulation. The exploration of WNK3 recombinant protein not only advances our knowledge of kidney function and vascular regulation but also contributes to the broader understanding of kinase biology in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US