Cat: PAX2000-12565

Recombinant Human WNK2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WNK2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    WNK2; KIAA1760; PRKWNK2; SDCCAG43; P/OKcl.13; Serine/threonine-Protein kinase WNK2; EC 2.7.11.1; Antigen NY-CO-43; Protein kinase lysine-deficient 2; Protein kinase with no lysine 2; Serologically defined colon cancer antigen 43

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y3S1

  • Expression Region

    1-489aa

  • AA Sequence

    MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESD QEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERARGRPAAPAPAA LVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAAT VRKEDEGAAEAKPEPGRTRRDEPEEEEDDEDDLKAVATSLDGRFLKFDIE LGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQ HPNIVRFYDFWESSAKGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRS WCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKR ASFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQ NAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGK

  • Molecular Weight

    100 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WNK2 is a member of the WNK (with no lysine [K]) kinase family, which plays a crucial role in the regulation of ion transport and blood pressure homeostasis through its effects on sodium, potassium, and chloride ion channels. Mutations in the WNK2 gene have been associated with various renal and cardiovascular disorders, highlighting its significance in physiological and pathological processes. Research on WNK2 recombinant proteins has gained momentum as scientists aim to elucidate the molecular mechanisms underpinning its function in cells. Recombinant WNK2 proteins enable detailed studies of their biochemical properties, interaction with other proteins, and their role in signaling pathways. This research is essential for understanding the implications of WNK2 in diseases such as hypertension and renal dysfunction. Investigating WNK2's interactions with other signaling molecules can also provide insights into potential therapeutic targets. Additionally, findings from WNK2 studies contribute to the broader understanding of the WNK kinase family's involvement in various cellular processes and their potential roles in novel treatment strategies. Thus, the characterization of WNK2 recombinant proteins is a promising avenue for advancing our knowledge of kidney physiology and associated disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US