Analytical Data
-
Gene name
TAS2R60
- Application
-
Alternative Names
TAS2R60; Taste receptor type 2 member 60; T2R60; Taste receptor type 2 member 56; T2R56
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P59551
-
Expression Region
1-318 aa
-
AA Sequence
MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLV SLGASRFCLQSVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCV KIATFTHPVFFWLKHKLSGWLPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNV TGDSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHRKKALLTTSGFREPSVQ AHIKALLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSN CRLRAVLKSRRSSRCGTP
-
Molecular Weight
36.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAS2R60 is a member of the TAS2R family of taste receptors, specifically involved in the detection of bitter compounds. Research on TAS2R60 has gained significance due to its potential role in influencing dietary choices and health outcomes, as bitter taste perception is often linked to the aversion of toxic substances. Genetic variations in TAS2R genes can affect individual sensitivity to bitterness, which in turn may influence food preferences and dietary habits. Moreover, TAS2R60 and other bitter taste receptors are not limited to the gustatory system; they are also expressed in various tissues, including the gastrointestinal tract and respiratory system, suggesting additional physiological roles beyond taste. The study of TAS2R60 through recombinant protein techniques allows researchers to investigate its structure, function, and signaling pathways in detail. Understanding how TAS2R60 interacts with specific ligands and its downstream effects can provide insights into the basic mechanisms of taste perception and its implications for nutrition, health, and disease. Additionally, this research may pave the way for novel therapeutic strategies targeting bitter taste receptors to manage conditions such as obesity or metabolic disorders.
