Analytical Data
-
Gene name
DSCR1L1
- Application
-
Alternative Names
Calcipressin 2; Calcipressin-2; CSP2; Down syndrome candidate region 1-like 1; Down syndrome critical region gene 1 like 1 protein; DSCR1L1; MCIP2; Myocyte enriched calcineurin interacting protein 2; Myocyte-enriched calcineurin-interacting protein 2; RCAN2; RCAN2_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14206
-
Expression Region
1-225aa
-
AA Sequence
MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAACSFSIIAVSSLSCFFPLLFVKKNCL
-
Molecular Weight
51.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The DSCR1L1 protein, a member of the Down Syndrome Critical Region 1 (DSCR1) gene family, has garnered significant attention in recent years due to its potential implications in various biological processes and diseases. Initially identified as a gene located within the critical region associated with Down syndrome, DSCR1L1 has been implicated in cellular stress responses, neuronal development, and immune regulation. Its expression has been found to be upregulated in certain pathological conditions, including neurodegenerative diseases and cardiac hypertrophy, suggesting a role in modulating cellular homeostasis and apoptosis. Additionally, research has highlighted DSCR1L1's potential as a biomarker for various diseases and its involvement in signaling pathways that influence cellular proliferation and differentiation. Given the growing interest in understanding the molecular mechanisms underlying its function, studies are now focusing on characterizing the protein's structure, its interactions with other cellular components, and its functional implications in health and disease. Insights gained from these investigations may contribute to the development of therapeutic strategies targeting DSCR1L1-related pathways, ultimately enhancing our understanding of complex conditions such as Down syndrome, cancer, and neurodegenerative disorders.











