Cat: PA2000-7214

Recombinant Human DSCR1L1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DSCR1L1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Calcipressin 2; Calcipressin-2; CSP2; Down syndrome candidate region 1-like 1; Down syndrome critical region gene 1 like 1 protein; DSCR1L1; MCIP2; Myocyte enriched calcineurin interacting protein 2; Myocyte-enriched calcineurin-interacting protein 2; RCAN2; RCAN2_HUMAN

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14206

  • Expression Region

    1-225aa

  • AA Sequence

    MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAACSFSIIAVSSLSCFFPLLFVKKNCL

  • Molecular Weight

    51.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The DSCR1L1 protein, a member of the Down Syndrome Critical Region 1 (DSCR1) gene family, has garnered significant attention in recent years due to its potential implications in various biological processes and diseases. Initially identified as a gene located within the critical region associated with Down syndrome, DSCR1L1 has been implicated in cellular stress responses, neuronal development, and immune regulation. Its expression has been found to be upregulated in certain pathological conditions, including neurodegenerative diseases and cardiac hypertrophy, suggesting a role in modulating cellular homeostasis and apoptosis. Additionally, research has highlighted DSCR1L1's potential as a biomarker for various diseases and its involvement in signaling pathways that influence cellular proliferation and differentiation. Given the growing interest in understanding the molecular mechanisms underlying its function, studies are now focusing on characterizing the protein's structure, its interactions with other cellular components, and its functional implications in health and disease. Insights gained from these investigations may contribute to the development of therapeutic strategies targeting DSCR1L1-related pathways, ultimately enhancing our understanding of complex conditions such as Down syndrome, cancer, and neurodegenerative disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US