Analytical Data
-
Gene name
LAMb1
- Application
-
Alternative Names
LAMb1；Laminin subunit beta-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07942
-
Expression Region
1533-1782aa
-
AA Sequence
MPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVY
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMB1 is a critical gene that encodes for the beta-1 chain of laminin, a key component of the extracellular matrix (ECM) that plays a vital role in cell adhesion, differentiation, and migration. Laminins are essential for maintaining the structural integrity of tissues and for facilitating cellular communication. Research on LAMB1 has gained significant attention due to its implication in various developmental processes and its association with several diseases, including muscular dystrophies and certain forms of cancer. The recombinant LAMB1 protein is studied to better understand its functional properties and the mechanisms governing laminin interactions with cells. By producing this protein in a controlled environment, researchers aim to investigate its influence on cell behavior and to explore potential therapeutic applications. The study of recombinant LAMB1 not only advances our knowledge of ECM biology but also holds promise for developing targeted treatments that could mitigate the effects of diseases linked to laminin deficiencies or dysregulation. Thus, the research surrounding LAMB1 recombinant protein stands at the intersection of molecular biology and clinical application, addressing both fundamental biological questions and paving the way for innovative therapeutic strategies.
