Analytical Data
-
Gene name
LAMR1
- Application
-
Alternative Names
LAMR1;LAMBR;LAMR1;Small ribosomal subunit Protein uS2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08865
-
Expression Region
1-295aa
-
AA Sequence
MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIIN LKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIA GRFTPGTFTNQIQAAFREPRLLVVTDPRAGHQPLTEASYVNLPTIALCNT DSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPD LYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSE GVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS
-
Molecular Weight
59 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMR1, a key protein involved in lipid metabolism and cellular regulation, has garnered significant attention in biomedical research due to its potential implications in various diseases, including metabolic disorders and cancers. The protein's role in the modulation of cellular pathways that affect lipid homeostasis and energy balance makes it a valuable target for therapeutic intervention. Recent studies have indicated that LAMR1 is involved in processes such as adipocyte differentiation and insulin signaling, linking it directly to obesity and type 2 diabetes. Furthermore, its expression levels have been associated with tumor progression in certain cancer types, suggesting that LAMR1 may function as a biomarker or a therapeutic target. Given the complexities of its interactions within metabolic networks, researchers are increasingly focused on the recombinant production of LAMR1 to elucidate its functional mechanisms and potential applications in drug development. By employing techniques such as protein engineering and recombinant DNA technology, scientists aim to produce high-yield, biologically active forms of LAMR1, which can facilitate in vitro and in vivo studies. Through these efforts, the ongoing research seeks to unlock the therapeutic potential of LAMR1, providing insights that could lead to innovative treatments for metabolic diseases and certain malignancies.











