Cat: PA2000-7209

Recombinant Human DRF1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DRF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DIAPH1; deafness; autosomal dominant 1; DFNA1; DIA1; DIAP1; DIAP1_HUMAN; DIAPH1; Diaphanous homolog 1 (Drosophila); diaphanous homolog 1; Diaphanous related formin 1; Diaphanous-related formin-1; DRF1; FLJ25265

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60610

  • Expression Region

    1-170aa

  • AA Sequence

    MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA

  • Molecular Weight

    44.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DRF1, or "Disrupted in Schizophrenia 1," is a protein that has garnered considerable attention in recent years due to its potential implications in various neurobiological processes and mental health conditions. Initially identified through genetic studies linking it to schizophrenia, DRF1 has been implicated in neurodevelopmental disorders and mechanisms of synaptic functioning. Research indicates that DRF1 plays a critical role in regulating gene expression, cellular signaling, and possibly the integrity of neuronal connections. Given its involvement in such fundamental processes, scientists have begun to focus on the recombinant production of DRF1 to explore its structure and function in greater detail. The study of DRF1 as a recombinant protein allows researchers to elucidate its molecular interactions, post-translational modifications, and the pathways it influences. Recent advances in protein engineering and expression systems facilitate the investigation of DRF1's functional roles and its potential as a therapeutic target. By further understanding DRF1's biological significance, researchers hope to uncover novel insights into the pathophysiology of schizophrenia and related disorders, ultimately contributing to the development of targeted treatments and interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US