Analytical Data
-
Gene name
DRF1
- Application
-
Alternative Names
DIAPH1; deafness; autosomal dominant 1; DFNA1; DIA1; DIAP1; DIAP1_HUMAN; DIAPH1; Diaphanous homolog 1 (Drosophila); diaphanous homolog 1; Diaphanous related formin 1; Diaphanous-related formin-1; DRF1; FLJ25265
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60610
-
Expression Region
1-170aa
-
AA Sequence
MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA
-
Molecular Weight
44.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DRF1, or "Disrupted in Schizophrenia 1," is a protein that has garnered considerable attention in recent years due to its potential implications in various neurobiological processes and mental health conditions. Initially identified through genetic studies linking it to schizophrenia, DRF1 has been implicated in neurodevelopmental disorders and mechanisms of synaptic functioning. Research indicates that DRF1 plays a critical role in regulating gene expression, cellular signaling, and possibly the integrity of neuronal connections. Given its involvement in such fundamental processes, scientists have begun to focus on the recombinant production of DRF1 to explore its structure and function in greater detail. The study of DRF1 as a recombinant protein allows researchers to elucidate its molecular interactions, post-translational modifications, and the pathways it influences. Recent advances in protein engineering and expression systems facilitate the investigation of DRF1's functional roles and its potential as a therapeutic target. By further understanding DRF1's biological significance, researchers hope to uncover novel insights into the pathophysiology of schizophrenia and related disorders, ultimately contributing to the development of targeted treatments and interventions.
