Analytical Data
-
Gene name
FOXA1
- Application
-
Alternative Names
FOXA1；HNF3A；TCF3A；Hepatocyte nuclear factor 3-alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55317
-
Expression Region
1-472aa
-
AA Sequence
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
-
Molecular Weight
56.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FOXA1, also known as Forkhead box A1, is a transcription factor that plays a crucial role in various biological processes, including development, metabolism, and cell differentiation. Its importance has become increasingly evident in cancer research, particularly in hormone-responsive tumors such as breast and prostate cancers. FOXA1 acts as a pioneer factor, influencing chromatin accessibility and facilitating the binding of other transcription factors, such as estrogen receptors. Abnormal expression or mutation of FOXA1 has been implicated in oncogenesis, highlighting the need for a deeper understanding of its function and regulatory mechanisms. The study of recombinant FOXA1 protein is essential for deciphering its pathways and interactions at the molecular level. Researchers utilize recombinant techniques to produce FOXA1 for functional assays and structural studies, aiming to uncover the precise role of FOXA1 in gene regulation and its potential as a therapeutic target. Advances in our understanding of FOXA1’s structure and function may contribute to the development of innovative treatment strategies for cancers driven by aberrant FOXA1 activity, ultimately leading to improved patient outcomes.
