Analytical Data
-
Gene name
WDR6
- Application
-
Alternative Names
WDR6; tRNA (34-2'-O)-methyltransferase regulator WDR6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NNW5
-
Expression Region
1-289 aa
-
AA Sequence
MHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD
-
Molecular Weight
57.53 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WDR6 (WD-repeat-containing protein 6) is a member of the WD-repeat protein family, known for its role in various cellular processes, including cell division, gene regulation, and signaling pathways. The protein's function has garnered interest due to its potential involvement in several diseases, including cancer. Recent studies have suggested that WDR6 is a crucial component of the spliceosome—a complex responsible for pre-mRNA splicing—which plays a vital role in gene expression and cellular function. Additionally, WDR6 has been implicated in the regulation of the cell cycle and apoptosis, making it a significant target for cancer research. The recombinant expression and characterization of WDR6 provide valuable insights into its structural and functional properties, facilitating the understanding of its biological roles. Advances in recombinant protein technology allow researchers to produce adequate amounts of WDR6 for in vitro studies, enabling the exploration of its interaction with other cellular components. Furthermore, understanding the mechanisms by which WDR6 contributes to disease processes can aid in the development of novel therapeutic strategies, particularly in targeting aberrant splicing events linked to tumorigenesis. Overall, the study of WDR6 as a recombinant protein holds promise for elucidating its functions in health and disease, contributing to the broader field of molecular biology and medical research.
