Analytical Data
-
Gene name
TADA3L
- Application
-
Alternative Names
TADA3; ADA3; TADA3L; Transcriptional adapter 3; ADA3 homolog; hADA3; STAF54; Transcriptional adapter 3-like; ADA3-like protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75528
-
Expression Region
1-238 aa
-
AA Sequence
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVD
-
Molecular Weight
53.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TADA3L, a member of the TADA (transcriptional adapter) family, plays a crucial role in regulating gene expression by linking transcription factors to the core transcriptional machinery. Investigations into TADA3L highlight its involvement in diverse biological processes, including embryonic development and immune response. Dysregulation of TADA3L has been associated with various diseases, including certain cancers and autoimmune disorders, underscoring its potential as a therapeutic target. Research into the biochemical properties and functions of TADA3L has gained momentum, particularly in understanding its role in chromatin remodeling and transcriptional activation. By facilitating the recruitment of histone acetyltransferases and other co-activators, TADA3L is integral to the regulation of genes critical for cell growth and differentiation. Moreover, advancements in protein engineering and structural biology have enabled scientists to elucidate the molecular mechanisms underlying TADA3L function, paving the way for innovative strategies in drug design and gene therapy. Understanding the functional dynamics of TADA3L not only enhances our knowledge of transcriptional regulation but also holds promise for developing novel interventions that can modulate its activity in pathological conditions.
