Analytical Data
-
Gene name
IL26
- Application
-
Alternative Names
IL26；AK155；Interleukin-26
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPH9
-
Expression Region
22-171aa
-
AA Sequence
KHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIKNIRLLKKKT KKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSHC ISCASSAREMKSITRMKRIFYRIGNKGIYKAISELDILLSWIKKLLESSQ
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin 26 (IL-26) is a member of the IL-10 cytokine family and plays a significant role in immune responses, particularly in inflammatory pathways associated with autoimmune diseases and microbial infections. Emerging research has demonstrated that IL-26 is primarily produced by T cells, especially Th17 cells, and exhibits various biological functions, including the modulation of innate immune cell activity and the promotion of T cell responses. Its involvement in chronic inflammatory conditions, such as psoriasis and rheumatoid arthritis, has sparked interest in understanding its mechanisms of action. The recombinant expression of IL-26 has become a crucial focus for researchers aiming to explore its potential therapeutic applications. By producing IL-26 in a recombinant form, scientists can study its precise biological activities and interactions with other cytokines and immune cells. Additionally, the recombinant protein can serve as a tool for assessing IL-26’s role in disease models, offering insights into its pathogenic mechanisms. Understanding the structure-function relationship of IL-26 through recombinant proteins may facilitate the development of targeted therapies aimed at modulating its activity, thus holding promise for the treatment of various inflammatory diseases. The ongoing research on recombinant IL-26 is expected to contribute significantly to the fields of immunology and therapeutic design by elucidating its complex roles in the immune system and disease.
