Cat: PA1000-8046

Recombinant Human LECT2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LECT2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LECT2;Leukocyte cell-derived chemotaxin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14960

  • Expression Region

    19-151aa

  • AA Sequence

    GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYA PFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGE KLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYL

  • Molecular Weight

    16 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LECT2, or leukocyte-derived chemotactic factor 2, is a secreted protein that plays a pivotal role in immune responses and inflammatory processes. Initially identified as a protein expressed by leukocytes, LECT2 has garnered attention due to its involvement in various physiological and pathological contexts, including autoimmune diseases, cancer, and metabolic disorders. Research has shown that LECT2 can modulate the migration and activation of immune cells, suggesting its potential as a therapeutic target. Additionally, studies indicate that altered levels of LECT2 are associated with conditions such as obesity and kidney diseases, prompting investigations into its role in metabolic regulation. The ability of LECT2 to interact with different cell types and impact signaling pathways makes it a compelling subject for further exploration. Recent advancements in recombinant protein technology have facilitated the production and characterization of LECT2, allowing researchers to delve into its functional properties and mechanisms of action. Understanding LECT2's structure-function relationship and its interactions within the immune system could lead to novel insights in immunology and potential therapeutic applications for diseases where immune dysregulation is a key factor.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US