Analytical Data
-
Gene name
SYT7
- Application
-
Alternative Names
SYT7; PCANAP7; Synaptotagmin-7; IPCA-7; Prostate cancer-associated protein 7; Synaptotagmin VII; SytVII
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43581
-
Expression Region
41-139 aa
-
AA Sequence
CQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRI
-
Molecular Weight
36.63kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYT7, or synaptotagmin 7, is a member of the synaptotagmin family of proteins, which play crucial roles in neurotransmitter release and synaptic transmission. Recent research has highlighted its importance in calcium-dependent exocytosis, a fundamental process in neuronal communication. Unlike other synaptotagmins that primarily function in synaptic vesicle release, SYT7 is implicated in the regulation of late endocytic and secretory pathways and may interact with different types of membrane traffic beyond the synapse, such as in the release of hormones and other bioactive substances. Studies have indicated that SYT7 could be a key player in various physiological processes and pathophysiological conditions, including neurodegenerative diseases, given its involvement in vesicle trafficking. Understanding the structure and function of the SYT7 protein is essential for elucidating its role in cellular mechanisms and could potentially lead to novel therapeutic targets for treating disorders related to impaired synaptic transmission. Therefore, the characterization of recombinant SYT7 protein is pivotal in providing insights into its molecular mechanisms, interactions, and overall contributions to cellular signaling pathways. This research not only advances our understanding of synaptic physiology but also opens avenues for exploring its implications in broader biomedical contexts.
