Analytical Data
-
Gene name
SYNGR3
- Application
-
Alternative Names
SYNGR3; Synaptogyrin-3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43761
-
Expression Region
1-145 aa
-
AA Sequence
MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCVFNGNAGACRFGVALGLGAFLACAAFLLLDVRFQQSGGRGKTPPSPQDWGSWPLFPSHVPVGSDCLVSVMVVRPVRSHSPLSLTGC
-
Molecular Weight
41.69kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SYNGR3 (Synaptogyrin 3) is a member of the synaptogyrin family of proteins, which are known to be involved in synaptic function and neurotransmitter release in the nervous system. Emerging research has highlighted SYNGR3's role in synaptic plasticity, a fundamental process underlying learning and memory. Dysregulation of SYNGR3 expression has been associated with various neurological disorders, including schizophrenia and autism spectrum disorders, making it a significant focus for studying neurodevelopmental and neuropsychiatric conditions. Moreover, SYNGR3's interactions with other synaptic proteins suggest that it may play a critical role in the formation and maintenance of synapses. The production of recombinant SYNGR3 protein allows researchers to investigate its structural and functional properties in detail, as well as to explore its potential as a therapeutic target. Understanding the mechanistic underpinnings of SYNGR3's function could provide valuable insights into the cellular and molecular bases of synaptic transmission and its implications for brain health and disease. This research is particularly relevant in the context of developing novel strategies for the treatment of related neurological disorders, where therapeutic agents targeting synaptic pathways may offer new avenues for intervention. Thus, the study of SYNGR3 recombinant protein holds promise for enhancing our understanding of neuronal communication and its significance in maintaining cognitive functions.
