Analytical Data
-
Gene name
WDR4
- Application
-
Alternative Names
OTTHUMP00000109401; OTTHUMP00000109402; TRM82; tRNA (guanine N(7) ) methyltransferase subunit WDR4; tRNA (guanine-N(7)-)-methyltransferase subunit WDR4; WD repeat containing Protein 4; WD repeat Protein 4; WD repeat Protein domain 4 Protein isoform 2; WD repeat-containing Protein 4; wdr4; WDR4_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57081
-
Expression Region
2-412 aa
-
AA Sequence
AGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGS GAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVAD KSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIE SFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAP QKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQ GLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLY KATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC
-
Molecular Weight
45.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WDR4, or WD repeat-containing protein 4, is a critical component involved in various cellular processes, including RNA processing, gene regulation, and chromatin remodeling. Its role in the assembly of multiprotein complexes has made it a focal point of research in understanding fundamental biological mechanisms. Studies have shown that WDR4 is integral to the function of the SLBP (Stem-Loop Binding Protein) in histone mRNA processing and contributes to the expression of genes related to cell proliferation and differentiation. Dysregulation of WDR4 has been implicated in several diseases, particularly cancer, where alterations in its expression can influence tumor growth and metastasis. Given the importance of WDR4 in essential cellular functions and its potential link to disease, researchers aim to better understand its structure and function through the production of recombinant WDR4 protein. This approach facilitates in-depth studies of its interactions with other proteins and its role in cellular pathways. By elucidating the molecular mechanisms associated with WDR4, scientists hope to uncover new therapeutic targets and develop strategies for treating diseases associated with its dysfunction. The ongoing investigation into WDR4's properties and its implications in health and disease underscores its significance in molecular biology and biomedical research.
