Analytical Data
-
Gene name
GAL12
- Application
-
Alternative Names
GAL12；GK2；N-acetylgalactosamine kinase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A7L0LBI1
-
Expression Region
1-65aa
-
AA Sequence
MGILVLVFIFISLTQHGDAHGPDICNHGGGLCRMGTCDSGEYPAQFCFEPVILCCKNPSAATTES
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The GAL12 protein, a key component of the GAL regulon in yeast, plays a pivotal role in the regulation of galactose metabolism. This protein is critical for the proper functioning of the galactose utilization pathway, which allows yeast to utilize galactose as a carbon source by converting it into glucose. Research into GAL12 has gained attention due to its involvement in the complex interplay between metabolic pathways and gene regulation. Understanding GAL12's function not only sheds light on the mechanisms of carbohydrate metabolism in yeast but also has broader implications for biotechnology, where yeast is frequently used in fermentation and biofuel production. Studies have shown that GAL12 interacts with various transcription factors, influencing the transcription of genes involved in galactose metabolism. Moreover, mutations in the GAL12 gene can lead to defects in galactose utilization, underscoring its importance in cellular metabolism. As researchers continue to explore the structural and functional aspects of GAL12, valuable insights are expected to emerge concerning metabolic regulation, potential applications in industrial biotechnology, and the evolutionary significance of metabolic adaptability in organisms. The ongoing investigation into this protein highlights not only its relevance in basic research but also its potential to inform strategies for improving yeast strains used in biotechnological applications.
