Cat: PA1000-8032

Recombinant Human GAL8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GAL8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GAL8;Galactose/lactose metabolism regulatory Protein GAL80

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00214

  • Expression Region

    1-317aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMMLSLNNLQNIIYNPVIPFVGTIPDQLDPG TLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNT LINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRI GPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGT PQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHL NPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKV AVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Galectin-8 (GAL8) is a member of the galectin family, which are β-galactoside-binding proteins involved in various biological processes, including cell adhesion, migration, and apoptosis. It is primarily expressed in various tissues, and its expression is often upregulated in pathological conditions such as cancer and inflammation. Research into GAL8 has gained significant attention due to its potential role in modulating immune responses and tumor progression. In cancer, GAL8 can influence tumor cell behavior by interacting with glycoproteins on the cell surface, thereby affecting signaling pathways that govern cell proliferation and survival. Moreover, GAL8 has been implicated in the regulation of immune cell functions, including T cell activation and antigen presentation, highlighting its dual role in tumor immunity. The study of recombinant GAL8 proteins allows for a deeper understanding of its structure-function relationships, potential therapeutic applications, and mechanisms of action. By producing and characterizing GAL8 in a controlled environment, researchers can investigate its interactions with other biomolecules and its effects on cellular processes. This research aims to elucidate the full spectrum of GAL8's biological significance and explore its utility as a biomarker or therapeutic target in cancer and other diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US