Analytical Data
-
Gene name
GAL9B
- Application
-
Alternative Names
GAL9B；LOC108276973；Galectin
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A0S1U0D8
-
Expression Region
1-349aa
-
AA Sequence
MVILHCITMSCQRPYLNPRLPFTGCIQGGLFEGKTVTVTGRVLAGAERFCVNLLCVTNTSSDIILHFNPRYRGNSGHVVCNTLQSSCWGSEQRSKHTPLPRGSDFILTFLVNRDSYSVIVNGAHFMEYLHRLPVSSVNAIFVDGGVEVTSITFQNPAVIIDRGRPMQPEKQRYRSKLTRGSGWNMQGHQKHASQIQALAACDVADLSAAPPPYSSQPAYVIPYKTIIQGGFYPCRGITVQGCVNHNADRFDINLRYNSGIAFHFNPRFDENVVVRNSLMKERWGREERSGGMPFYRGQPFTVSITCDTQCYRIAVNGTQMFTYNHRHFLFQQIDILEVDGNISVSSVVV
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Galectin-9B (Gal9B) is a member of the galectin family, characterized by its evolutionary conservation and unique carbohydrate-binding properties. Galectins, including Gal9B, play pivotal roles in various biological processes such as cell adhesion, proliferation, differentiation, and apoptosis. The study of Gal9B is particularly relevant in the context of immune regulation, as it has been implicated in modulating immune responses, influencing T cell activation, and participating in tumor immune evasion mechanisms. Additionally, Gal9B has shown potential as a biomarker for several diseases, including cancer and autoimmune disorders. The recombinant expression of Gal9B in suitable host systems allows for the production of this protein in large quantities, facilitating detailed biochemical and functional analyses. Understanding the structure-function relationship of Gal9B is crucial for deciphering its role in pathological conditions and may pave the way for therapeutic applications, such as immunotherapeutics or targeted drug delivery systems. Moreover, research focusing on the glycosylation patterns and interactions of Gal9B with other cellular molecules can provide insights into its mechanistic pathways, potentially revealing novel targets for intervention in diseases where galectins are dysregulated. As research progresses, the exploration of Gal9B's functions and applications continues to garner interest, highlighting its significance in both basic and applied biomedical sciences.
