Analytical Data
-
Gene name
GALC
- Application
-
Alternative Names
GALC；Galactocerebrosidase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54803
-
Expression Region
43-685aa
-
AA Sequence
YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFTSGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEATR
-
Molecular Weight
73.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of GALC (galactocerebrosidase) recombinant protein is primarily rooted in the understanding and treatment of Krabbe disease, a rare and fatal neurological disorder caused by the deficiency of this enzyme. GALC plays a crucial role in the metabolism of galactolipids, particularly in the degradation of galactocerebroside into ceramide and galactose. When GALC is deficient, toxic substances accumulate in the nervous system, leading to severe demyelination, neuroinflammation, and progressive neurological deterioration. Research into GALC recombinant protein aims to develop effective enzyme replacement therapies and gene therapies that can restore the function of this enzyme in affected individuals. Advances in biotechnology have enabled the expression of GALC in various systems, allowing for the study of its structure, function, and potential therapeutic applications. By understanding the enzyme's properties and optimizing its delivery methods, researchers hope to alleviate the symptoms of Krabbe disease and improve the quality of life for patients. Ongoing studies also focus on elucidating the biochemical pathways associated with GALC and identifying biomarkers for early diagnosis, paving the way for more effective therapeutic strategies. Overall, GALC recombinant protein research is a vital area of investigation with the potential to significantly impact the treatment of Krabbe disease and other related disorders.
