Analytical Data
-
Gene name
WDR39
- Application
-
Alternative Names
Probable cytosolic iron-sulfur Protein assembly Protein CIAO1. WD repeat-containing Protein 39
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O76071
-
Expression Region
1-339 aa
-
AA Sequence
MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL
-
Molecular Weight
63.03 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WDR39, a member of the WD repeat protein family, has garnered significant attention in recent years due to its involvement in various cellular processes, including RNA splicing, signal transduction, and cellular stress responses. Studies have indicated that WDR39 may play a crucial role in coordinating the activity of multiprotein complexes, which are essential for maintaining cellular homeostasis and regulating gene expression. Despite its potential importance, relatively little is known about the specific biochemical functions and pathways associated with WDR39. Recent research has focused on the recombinant expression of WDR39 to elucidate its structural properties and interaction partners, providing insight into its functional mechanisms at a molecular level. By producing WDR39 as a recombinant protein, researchers aim to facilitate the characterization of its binding affinities and post-translational modifications, thereby unlocking its role in pathophysiological conditions. Understanding the intricate functionalities of WDR39 could pave the way for new therapeutic strategies targeting related diseases, making it a compelling subject for ongoing research in molecular biology and biomedical sciences.
