Analytical Data
-
Gene name
RELA
- Application
-
Alternative Names
RELA；IASPP；NKIP1；PPP1R13BL；RelA-associated inhibitor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q04206
-
Expression Region
1-210aa
-
AA Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD
-
Molecular Weight
1-210aa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RELA, a pivotal component of the NF-κB signaling pathway, plays a critical role in regulating immune responses, inflammation, and cell survival. The RELA protein, or p65, serves as a transcription factor that influences the expression of various genes involved in these biological processes. Dysregulation of RELA has been implicated in various diseases, including cancer, autoimmune disorders, and chronic inflammatory conditions. Researchers have increasingly focused on the study of recombinant RELA proteins to elucidate their structure-function relationships and their interactions with other molecular partners. The development of recombinant RELA offers valuable insights into the functional mechanisms of this protein and opens avenues for potential therapeutic interventions targeting NF-κB signaling. By producing RELA in a controlled laboratory setting, scientists are able to perform detailed functional assays, characterizing its activity, understanding its role in cellular signaling, and exploring ways to modulate its activity for therapeutic benefit. Furthermore, studying RELA in a recombinant form allows for the identification of post-translational modifications and interacting partners, which are crucial for its activation and function. Consequently, ongoing research into recombinant RELA not only enhances the understanding of its biological significance but also contributes to the discovery of novel strategies for drug development aimed at diseases associated with aberrant NF-κB signaling.
