Analytical Data
-
Gene name
RELB
- Application
-
Alternative Names
RELB；Transcription factor RelB
-
Species
Escherichia
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C079
-
Expression Region
1-79aa
-
AA Sequence
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
-
Molecular Weight
16.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RELB, a member of the NF-κB family of transcription factors, plays a crucial role in immune response, inflammation, and cell survival. Research on RELB has gained momentum due to its involvement in various pathological conditions, including cancer, autoimmune diseases, and chronic inflammatory disorders. Unlike its better-studied counterparts, such as NF-κB p65, RELB operates primarily in the context of the non-canonical NF-κB signaling pathway, which is triggered by specific receptors, including BAFFR and CD40. This pathway is essential for the development of certain immune cells, particularly dendritic cells and B cells. Dysregulation of RELB activity is implicated in tumor progression and the modulation of immune responses, making it a potential therapeutic target. Studies have shown that RELB can promote cell survival and proliferation, highlighting its dual role in both enhancing immune responses and facilitating tumor growth. Investigating the mechanisms by which RELB influences various cellular processes is critical for understanding its contributions to health and disease. Furthermore, as RELB functions in a network with other signaling molecules, elucidating its interactions and regulatory mechanisms could provide insights into novel therapeutic strategies aimed at modulating immune responses and treating related diseases. Consequently, the study of RELB is not only significant for basic biological research but also holds promise for clinical advancements in targeted therapies against cancer and inflammatory diseases.
