Analytical Data
-
Gene name
WDR21A
- Application
-
Alternative Names
DCAF4; DCAF4_HUMAN; DDB1 and CUL4 associated factor 4; DDB1- and CUL4-associated factor 4; WD repeat domain 21; WD repeat domain 21A; WD repeat-containing Protein 21A; WDR21 ; WDR21A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WV16
-
Expression Region
1-495 aa
-
AA Sequence
MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELRLSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLAETPGCATLLPASLFVNSHPGIDRPGMLCSFRIPGAWSCAWSLNIQANNCFSTGLSRRVLLTNVVTGHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKATRLFHDSAVTSVRILQDEQYLMASDMAGKIKLWDLRTTKCVRQYEGHVNEYAYLPLHVHEEEGILVAVGQDCYTRIWSLHDARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS
-
Molecular Weight
71.7kDa kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WDR21A, or WD repeat-containing protein 21A, is an emerging player in cellular processes characterized by its involvement in various biological functions, including gene expression regulation, cell cycle control, and DNA damage response. Researchers have increasingly focused on WDR21A due to its potential implications in disease mechanisms, particularly in cancer and neurodegenerative disorders. This protein's structure, featuring multiple WD40 repeats, suggests a role in protein-protein interactions, which are crucial for forming multiprotein complexes that modulate key cellular pathways. The study of recombinant WDR21A protein is essential to elucidate its biochemical properties and functional roles, as well as to explore its interactions with other molecules. Moreover, characterizing the WDR21A protein through techniques such as recombinant expression in bacterial or mammalian systems can facilitate the development of assays to study its activity, inhibitory compounds, and involvement in pathologies. Understanding WDR21A's functions at the molecular level may provide insights into novel therapeutic targets and strategies for intervention in diseases linked to its dysregulation. Continued research in this area holds promise for advancing our understanding of cellular mechanisms and the development of targeted therapies.
