Analytical Data
-
Gene name
WFDC5
- Application
-
Alternative Names
WFDC5；PRG5；WAP1；WAP four-disulfide core domain Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61964
-
Expression Region
1-334aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMATEEKKPETEAARAQPTPSSSATQSKPTP VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFE KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSN YVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYIL AATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW KSDC
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WFDC5 (WAP Four-Disulfide Core Domain 5) is a member of the whey acidic protein (WAP) family, which is characterized by a conserved structure featuring four disulfide bonds. This protein is predominantly expressed in epithelial tissues, including the lung, mammary gland, and other organs, where it plays a critical role in various biological processes, including modulation of inflammation, regulation of innate immunity, and contributions to tissue homeostasis. Recent investigations have highlighted the involvement of WFDC5 in several pathological conditions, such as respiratory diseases, cancer, and infections. Given its potential as a biomarker and therapeutic target, researchers have been focusing on the structural and functional characterization of WFDC5 recombinant proteins to elucidate their mechanisms of action. The production of WFDC5 as a recombinant protein allows for detailed studies of its biological functions, interaction with other proteins, and potential applications in drug development. Understanding the role of WFDC5 in human health and disease can pave the way for novel therapeutic strategies aimed at modulating its expression or activity for clinical benefits. Current research is also exploring the impact of post-translational modifications on WFDC5 activity and stability, further emphasizing the need for a comprehensive analysis of this protein in various contexts. Overall, the study of WFDC5 and its recombinant form holds significant promise for advancing our understanding of cellular regulation and developing innovative approaches to treat diseases associated with its dysregulation.
