Analytical Data
-
Gene name
SULT1C1
- Application
-
Alternative Names
humSULTC2; ST1C1 ; ST1C2; ST1C2_HUMAN; Sulfotransferase 1C1; Sulfotransferase 1C2; Sulfotransferase family cytosolic 1C member 1; Sulfotransferase family cytosolic 1C member 2; SULT1C#1; SULT1C1 ; SULT1C2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00338
-
Expression Region
1-296 aa
-
AA Sequence
MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
-
Molecular Weight
58.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SULT1C1, or Sulfotransferase 1C1, is a member of the sulfotransferase family of enzymes, which play a crucial role in the metabolism of various endogenous and exogenous compounds, including drugs, hormones, and environmental pollutants. This enzyme is primarily expressed in the liver and has been implicated in the sulfation of catecholamines and other phenolic compounds, thereby influencing their pharmacokinetics and biological activity. Given the importance of sulfation in drug metabolism and detoxification processes, SULT1C1 has garnered attention in pharmacological and toxicological studies. Additionally, variations in the expression and activity of SULT1C1 may contribute to interindividual differences in drug responses and adverse effects, making it an important target for both clinical and pharmaceutical research. Understanding the structure, function, and regulation of SULT1C1 through recombinant protein studies can provide valuable insights into its role in drug metabolism, paving the way for more personalized medicine approaches and the development of novel therapeutics. Research on the recombinant expression of SULT1C1 not only enhances our understanding of its enzymatic mechanisms but also provides a platform for screening drug candidates and understanding the biochemical pathways involved in sulfation.
