Analytical Data
-
Gene name
WNK1
- Application
-
Alternative Names
WNK1；HSN2；KDP；KIAA0344；Serine/threonine-Protein kinase WNK1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H4A3
-
Expression Region
181-507aa
-
AA Sequence
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIE
-
Molecular Weight
67 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WNK1, a member of the WNK (With No K) kinase family, plays a pivotal role in regulating ion homeostasis and blood pressure. Elevated levels of WNK1 have been implicated in several disorders, such as hypertension, heart disease, and certain forms of chronic kidney disease. This kinase is known for its unique regulatory mechanisms, including its interaction with the SPAK and OSR1 proteins, which are crucial in the signaling pathways controlling sodium and potassium transport in renal epithelial cells. Research into WNK1 recombinant proteins aims to elucidate the molecular mechanisms governing its activity and the pathways it influences. Given its involvement in essential physiological processes, WNK1 presents a compelling target for therapeutic intervention. Understanding the structure-function relationship of WNK1 through recombinant technology offers insights into the potential development of specific inhibitors or modulators that could ameliorate the effects of associated pathologies. As such, ongoing studies focus on the expression, purification, and functional characterization of WNK1 recombinant proteins, which could pave the way for innovative treatment strategies targeting the underlying causes of WNK1-related diseases.
