Analytical Data
-
Gene name
SUI1
- Application
-
Alternative Names
Eukaryotic translation initiation factor 1. eIF1. A121. Protein translation factor SUI1 homolog. Sui1iso1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P41567
-
Expression Region
1-113 aa
-
AA Sequence
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
-
Molecular Weight
38.17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SUI1, or Suppressor of Unusual Initiation 1, is a crucial protein involved in the initiation of translation, particularly in eukaryotic cells. Its primary function is to ensure the proper assembly of ribosomal components and facilitate the start of protein synthesis. Research on SUI1 has gained momentum due to its significant role in cellular processes and potential implications in understanding various diseases, including cancer and genetic disorders. The recombinant production of SUI1 offers a powerful approach to study its structure and function in detail, which is often challenging in native contexts. By utilizing advanced recombinant DNA technology, researchers can generate large quantities of SUI1 protein, allowing for biochemical assays, structural analysis, and functional studies. Investigating the interactions between SUI1 and other translation factors may reveal critical insights into translation regulation and its impact on cellular homeostasis. Furthermore, understanding SUI1’s mechanisms could lead to novel therapeutic strategies for diseases associated with translation dysregulation. Overall, SUI1 recombinant protein research is a promising area that contributes to our fundamental understanding of molecular biology and the intricate processes underlying gene expression.
