Analytical Data
-
Gene name
WBSCR17
- Application
-
Alternative Names
GALNT17; WBSCR17Polypeptide N-acetylgalactosaminyltransferase 17; EC 2.4.1.41; Polypeptide GalNAc transferase-like Protein 3; GalNAc-T-like Protein 3; pp-GaNTase-like Protein 3; Protein-UDP acetylgalactosaminyltransferase-like Protein 3; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like Protein 3; Williams-Beuren syndrome chromosomal region 17 Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6IS24
-
Expression Region
1-598 aa
-
AA Sequence
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQVTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELWCMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLDQGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLDCDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
-
Molecular Weight
94.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WBSCR17 is a gene associated with Williams-Beuren syndrome (WBS), a rare genetic disorder caused by a deletion of genetic material on chromosome 7. This syndrome is characterized by various developmental and cognitive challenges, along with distinctive facial features and a unique behavioral profile, including hyper-sociability. The WBSCR17 protein, encoded by this gene, is believed to play a critical role in neural development and function, though its specific biological functions remain largely unexplored. Research into the WBSCR17 recombinant protein aims to elucidate its structure and function, which could provide insights into the molecular mechanisms underlying WBS and potentially reveal therapeutic targets for managing its symptoms. Understanding the role of WBSCR17 in cellular processes may contribute to broader knowledge of neurodevelopmental disorders, highlighting the need for protein expression studies and functional assays to assess its effects in various biological contexts. Additionally, exploring the interactions of WBSCR17 with other proteins may facilitate the understanding of its role in cellular pathways relevant to WBS, paving the way for potential advancements in treatment strategies and interventions for affected individuals.
